4.05 Rating by CuteStat

fakirinyeri.com is 4 years 5 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, fakirinyeri.com is SAFE to browse.

PageSpeed Score
62
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 477
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

92.42.35.146

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 4 H2 Headings: 7
H3 Headings: 48 H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 49
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 92.42.35.146)

Bakım Modu

- celikkasaankara.com
Not Applicable $ 8.95

SESAM Sigorta

- sesamsigorta.com
Not Applicable $ 8.95

samancimedya.com

- samancimedya.com
Not Applicable $ 8.95

samanciailesiyardimlasmavakfi.com

- samanciailesiyardimlasmavakfi.com
Not Applicable $ 8.95

Samanci Ailesi Yardımlaşma Vakfı

- samancivakfi.com

Samanci Ailesi Yardımlaşma Vakfı

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Mon, 30 Dec 2019 17:21:41 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 6867
Connection: keep-alive
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip

Domain Information

Domain Registrar: NICS Telekomunikasyon A.S.
Registration Date: Dec 5, 2019, 2:14 PM 4 years 5 months 1 day ago
Expiration Date: Dec 5, 2020, 2:14 PM 3 years 4 months 4 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.inetmar.net 37.152.74.200 Türkiye Türkiye
ns2.inetmar.net 92.42.32.200 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
fakirinyeri.com A 10797 IP: 92.42.35.146
fakirinyeri.com NS 86400 Target: ns1.inetmar.net
fakirinyeri.com NS 86400 Target: ns2.inetmar.net
fakirinyeri.com SOA 10800 MNAME: ns1.inetmar.net
RNAME: admin.inetmar.com
Serial: 2019120502
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
fakirinyeri.com MX 14400 Target: fakirinyeri.com

Full WHOIS Lookup

Domain Name: FAKIRINYERI.COM
Registry Domain ID : 2463541794_DOMAIN_COM-VRSN
Registrar WHOIS Server : whois.nicproxy.com
Registrar URL: http://www.nicproxy.com
Updated Date: 2019-12-05T10:02:52Z
Creation Date: 2019-12-05T08:29:41Z
Registrar Registration Expiration Date: 2020-12-05T08:29:41Z
Registrar: NICS Telekomunikasyon A.S.
Registrar IANA ID: 1454
Registrar Abuse Contact Email: abuse@nicproxy.com
Registrar Abuse Contact Phone: +90.2122132963
Reseller: EUROTA INTERNET SERVICES LTD. STI.
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registrant Organization: SESA GRUP KOZMETIK MEDIKAL ILAC OTO KIRALAMA REKLAM SAN. TIC. A.
Registrant State / Province: Cankaya
Registrant Country: TR
Name Server: NS1.INETMAR.NET
Name Server: NS2.INETMAR.NET
DNSSEC: Unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>>Last update of WHOIS database: 2019-12-30T17:11:06Z<<<

For more information on Whois status codes, please visit https://icann.org/epp

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 04 Jun 2018.
Visit whois.nicproxy.com to look up contact data for domains
not covered by GDPR policy.

!****************************************************************************!
NICS Telekomunikasyon A.S., uluslararasi alan adi kayit otoritesi olan ICANN
onayli bir alan adi kayit firmasidir.
Bu alan adina ait web sitesinin icerigi ya da yayinlanmasiyla hicbir sekilde ilgisi yoktur.
Sadece, ICANN kurallari cercevesinde alan adinin kayit edilmesine aracilik yapmaktadir.

Bu alan adi sahibinin kayit sirasinda verdigi bilgiler yukaridaki gibidir.
NICS Telekomunikasyon A.S., bu bilgilerin dogrulugunu garanti edemez.
Daha fazla bilgi almak icin info [at] nicproxy.com adresine yazabilirsiniz.
!*****************************************************************************!


The data in the WHOIS database of NICS Telekomunikasyon A.S. is provided by
Nics Telekomunikasyon Ltd. for information purposes, and to assist persons in
obtaining information about or related to domain name registration
records. NICS Telekomunikasyon A.S. does not guarantee its accuracy.
By submitting a WHOIS query, you agree that you will use this data
only for lawful purposes and that, under no circumstances, you will
use this data to
1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via E-mail(spam) or
2) enable high volume, automated, electronic processes that apply
to Nics Telekomunikasyon Ltd. or its systems.
Nics Telekomunikasyon Ltd. reserves the right to modify these terms.
By submitting this query, you agree to abide by this policy.


NICProxy Whois Server Ver.1.1.2